Emoji Repo
Face With One Eyebrow Raised — Google Noto

🤨 raised eyebrow emoji

The raised eyebrow emoji 🤨 depicts a face with one eyebrow lifted. It is used to express skepticism, disbelief, distrust, disapproval, or mild surprise in conversations, especially in response to something questionable or unexpected.

Copies the character. Its appearance depends on where you paste it.

Unicode version
10.0
Release year
2017
Unicode sequence
U+1F928
Emoji version
5.0
Artwork
12 available designs
Compare designs →

What does 🤨 mean?

A facial expression with one eyebrow raised, indicating skepticism, doubt, or mild surprise. The face is typically neutral or slightly quizzical, with a straight mouth and one eyebrow arched higher than the other. This emoji conveys a questioning or dubious attitude, often used to express disbelief or curiosity.

Common uses

  • Expressing skepticism: 'Are you sure about that? 🤨'
  • Indicating doubt: 'That sounds too good to be true 🤨'
  • Showing mild surprise: 'You did what? 🤨'
disapprovaldisbeliefdistrustemojieyebrowfacehmmmildraisedskepticskepticalskepticismsurprisewhatmild surprisescepticismface with raised eyebrowface with one eyebrow raised

In a message

The report seems a bit off 🤨 Let's double-check the data.
I heard you got a promotion 🤨 Congratulations!
She said she finished the project in a day 🤨 I find that hard to believe.

Variations

This entry has no skin-tone variations in the current catalog. Different platform designs are renderings of the same character, not separate emoji.

Platform designs

Compare interpretations of the same character. Select a design for a closer look.

Google Noto

Local artworkPNG
Noto Color Emoji 2.051 render

Twemoji

Local artworkSVG
CC BY 4.0

Microsoft Fluent

Local artworkSVG
MIT

Apple

Platform artworkPNG

Google

Platform artworkPNG

Twitter

Platform artworkPNG

Facebook

Platform artworkPNG

Microsoft Fluent 3D

Platform artworkPNG
MIT

Your device

Device fontText
On your device

This is your browser’s own rendering. Copying an emoji copies text, not a platform image.

Artwork availability does not indicate support in a particular operating system.

Frequently asked questions

What does 🤨 mean?

A facial expression with one eyebrow raised, indicating skepticism, doubt, or mild surprise. The face is typically neutral or slightly quizzical, with a straight mouth and one eyebrow arched higher than the other. This emoji conveys a questioning or dubious attitude, often used to express disbelief or curiosity.

How do I copy Face With One Eyebrow Raised?

Click Copy emoji, then paste it into a message or text field. Use Ctrl+V on Windows or Cmd+V on Mac.

How do I download Face With One Eyebrow Raised?

Select a platform design, open its preview and choose Download. The available PNG or SVG format is shown for each design.

Does Face With One Eyebrow Raised support skin tones?

This entry has no skin-tone variations in the current catalog. Different platform designs are renderings of the same character, not separate emoji.