Emoji Repo
Japanese Ogre — Google Noto

👹 Japanese ogre emoji

The Japanese ogre emoji 👹 depicts the face of a Japanese ogre, a scary creature associated with fantasy and fairy tales. It is used in contexts related to monsters, devils, masks, and frightening characters. The emoji can also represent an ogre or troll in fictional stories.

Copies the character. Its appearance depends on where you paste it.

Unicode version
6.0
Release year
2010
Unicode sequence
U+1F479
Emoji version
0.6
Artwork
13 available designs
Compare designs →

What does 👹 mean?

A mythical creature resembling a fierce, red-skinned ogre with a large, menacing grin, sharp teeth, and horns. Often depicted with a blue or green hair tuft and a single or double horn on its forehead. Represents a Japanese ogre (Oni) from folklore, symbolizing evil, danger, or a mischievous character. Not to be confused with the Japanese goblin (Tengu) or other similar-looking emojis.

Common uses

  • Representing a mischievous or evil character: 'Watch out for the 👹 in the story!'
  • Symbolizing danger or a threat: 'Feeling like there's a 👹 lurking around the corner.'
  • Referring to a playful, mischievous person: 'He's such a 👹 when he plays pranks!'
creaturedevilfacefairyfairytalefantasymaskmonsterogrescarytaletrolljapanese ogre

In a message

In the game, the 👹 is the final boss you need to defeat.
She loves to tell scary stories about 👹 from Japanese folklore.
He's always the 👹 at Halloween parties, dressing up as an Oni.

Variations

This entry has no skin-tone variations in the current catalog. Different platform designs are renderings of the same character, not separate emoji.

Platform designs

Compare interpretations of the same character. Select a design for a closer look.

Google Noto

Local artworkPNG
Apache 2.0

Twemoji

Local artworkPNG
CC BY 4.0

Apple

Platform artworkPNG

Google

Platform artworkPNG

Twitter

Platform artworkPNG

Facebook

Platform artworkPNG

Microsoft Fluent 3D

Platform artworkPNG
MIT

Your device

Device fontText
On your device

This is your browser’s own rendering. Copying an emoji copies text, not a platform image.

Artwork availability does not indicate support in a particular operating system.

Frequently asked questions

What does 👹 mean?

A mythical creature resembling a fierce, red-skinned ogre with a large, menacing grin, sharp teeth, and horns. Often depicted with a blue or green hair tuft and a single or double horn on its forehead. Represents a Japanese ogre (Oni) from folklore, symbolizing evil, danger, or a mischievous character. Not to be confused with the Japanese goblin (Tengu) or other similar-looking emojis.

How do I copy Japanese Ogre?

Click Copy emoji, then paste it into a message or text field. Use Ctrl+V on Windows or Cmd+V on Mac.

How do I download Japanese Ogre?

Select a platform design, open its preview and choose Download. The available PNG or SVG format is shown for each design.

Does Japanese Ogre support skin tones?

This entry has no skin-tone variations in the current catalog. Different platform designs are renderings of the same character, not separate emoji.